{ "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/83892","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XIXwHaqegRQRLu3s8gB9gdxnThbPojcMuR3P0NJMFOk. { { "event" : "unapproveMessage", "useSubjectIcons" : "true", LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "useSubjectIcons" : "true", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); }, LITHIUM.Dialog.options['-2085039315'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "context" : "", LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); } { "event" : "ProductAnswer", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2044598,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "expandMessage", }, } "context" : "", } }, "displayStyle" : "horizontal", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", { }, $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "disallowZeroCount" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2044376,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:quiltName", "action" : "pulsate" { } "actions" : [ } "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }; "parameters" : { } var msg = $(".message-uid-2044598"); "defaultAriaLabel" : "", } LITHIUM.CustomEvent('.lia-custom-event', 'click'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ ] .attr('aria-selected','true'); Loggen Sie sich in Ihr PayPal-Konto ein. { { })(LITHIUM.jQuery); "revokeMode" : "true", "actions" : [ { "truncateBodyRetainsHtml" : "false", ] }, "context" : "", "event" : "MessagesWidgetEditAction", { { count = 0; { "context" : "", "actions" : [ "disallowZeroCount" : "false", { "action" : "rerender" "action" : "rerender" LITHIUM.Dialog.options['-2085039315'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,expandedQuiltName", { { $(document).ready(function(){ "event" : "RevokeSolutionAction", }(LITHIUM.jQuery)); Aufladen kann man das PayPal-Konto per Kreditkarte nicht, das funktioniert nur über ein Bankkonto. paypal hat mir ein betrag überwiesen mit code im verwendungszweck. return; "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "actions" : [ })(LITHIUM.jQuery); Choose interactive mode to make calls using your own credentials or use mock mode to simulate API calls. "event" : "ProductMessageEdit", { { ] } else { "context" : "", "action" : "addClassName" "context" : "envParam:selectedMessage", ], // We're good so far. } var element = $(this).parent('li'); } $(document).keydown(function(e) { "displayStyle" : "horizontal", // Oops, not the right sequence, lets restart from the top. Deine CallYa-Karte lädt sich automatisch auf, wenn Dein Guthaben weniger als 5 Euro beträgt. "context" : "lia-deleted-state", "actions" : [ "actions" : [ "}); "revokeMode" : "true", }, "useTruncatedSubject" : "true", ] // just for convenience, you need a login anyways... $(this).toggleClass("view-btn-open view-btn-close"); "context" : "envParam:selectedMessage", } lithadmin: [] ] { }, "action" : "rerender" "kudosable" : "true", "event" : "deleteMessage", ] }, "context" : "envParam:quiltName", Paypal und lastschrift funktioniert nicht über steam hi , habe mir meinen paypal account gemacht und dort meine bankverbindungsdaten eingegeben. { "disableKudosForAnonUser" : "false", "action" : "addClassName" "forceSearchRequestParameterForBlurbBuilder" : "false", } }, ;(function($) { ] var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { $('#node-menu li.active').children('ul').show(); "event" : "deleteMessage", "actions" : [ "truncateBody" : "true", "actions" : [ }, "context" : "", { }, "actions" : [ Learn more and manage your cookies. "componentId" : "forums.widget.message-view", { }, { "initiatorBinding" : true, { return; "disableLabelLinks" : "false", } { "action" : "rerender" }, //$('#vodafone-community-header').css('display','block'); }, "disableLabelLinks" : "false", { "actions" : [ { var keycodes = { { ] "actions" : [ "event" : "MessagesWidgetEditCommentForm", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { ] } ], }, "action" : "rerender" { } "eventActions" : [ "initiatorBinding" : true, }, { "disableLabelLinks" : "false", var key = e.keyCode; "message" : "2044376", logmein: [76, 79, 71, 77, 69, 73, 78], ] "context" : "lia-deleted-state", "}); })(LITHIUM.jQuery); // Pull in global jQuery reference "context" : "", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { var keycodes = { "componentId" : "forums.widget.message-view", LITHIUM.AjaxSupport.useTickets = false; "event" : "removeThreadUserEmailSubscription", Betragsauswahl, Anmeldedaten und Zahlungweise -> ok. 2. LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. Ist eine Lösung in Sicht ? } "action" : "rerender" "parameters" : { "actions" : [ "event" : "unapproveMessage", "event" : "editProductMessage", ] $(document).ready(function(){ "}); "actions" : [ Execute whatever should happen when entering the right sequence LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", })(LITHIUM.jQuery); "parameters" : { ] ] }, PayPal Purchase Protection is available for transactions for goods or services. "eventActions" : [ "action" : "rerender" "displayStyle" : "horizontal", { "action" : "rerender" Already set up to use your mobile number to log in? // We're good so far. "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_6d3610029e6f17', 'disableAutoComplete', '#ajaxfeedback_6d361001f0395a_0', 'LITHIUM:ajaxError', {}, 'Fs4LiZGvHJUTBa2_NEbYch5GVbm3RM_oC5KyPd2BPVs. { { "action" : "rerender" }, "action" : "rerender" { "action" : "rerender" }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2044598 .lia-rating-control-passive', '#form_2'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_6d361001f0395a","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_6d361001f0395a_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/CallYa/thread-id/83892&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8qpP4ZZtLfT2mY7byigJnJoTodgkIlHuQx3s1PwCjbU. notifCount = parseInt($(this).html()) + notifCount; "context" : "", "context" : "", "disableLinks" : "false", "context" : "", "disableLabelLinks" : "false", "event" : "MessagesWidgetAnswerForm", "displayStyle" : "horizontal", "event" : "MessagesWidgetEditCommentForm", { ', 'ajax'); "actions" : [ "event" : "ProductAnswer", { lithadmin: [] "event" : "markAsSpamWithoutRedirect", { }, { "truncateBody" : "true", "disableKudosForAnonUser" : "false", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "", } })(LITHIUM.jQuery); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); ] { } { element.siblings('li').find('li').removeClass('active'); ;(function($) { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); PayPal One Touch™ only works for checkout. "event" : "deleteMessage", { { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_6d361001f0395a_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/83892&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:entity", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_6d361001f0395a","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_6d361001f0395a_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/CallYa/thread-id/83892&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8qpP4ZZtLfT2mY7byigJnJoTodgkIlHuQx3s1PwCjbU. }, }, }); "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "actions" : [ { ] "revokeMode" : "true", ] "action" : "rerender" { } "event" : "MessagesWidgetMessageEdit", ] } ] "actions" : [ "context" : "", Die Callya-Flex-App funktioniert derzeit auf Android- und iOS-Geräten nicht. Meld Dich in wenigen Schritten an. { { }, "actions" : [ { }; "event" : "approveMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { ] { Bist du sicher, dass du fortfahren möchtest? "actions" : [ } { }, ] { }, All you need is an email address. "context" : "", .attr('aria-expanded','true'); "initiatorDataMatcher" : "data-lia-message-uid" } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { $(this).toggleClass("view-btn-open view-btn-close"); { "event" : "RevokeSolutionAction", "action" : "rerender" "disableLabelLinks" : "false", } "kudosLinksDisabled" : "false", "buttonDialogCloseAlt" : "Schließen", "componentId" : "kudos.widget.button", ] }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/83892","ajaxErrorEventName":"LITHIUM:ajaxError","token":"I9JuRRlID0Tuujya9hCZyTW5p5sO8czDrv6wjFK_z0c. // Oops. } ] ] { ] window.onload = function() { "activecastFullscreen" : false, "context" : "envParam:quiltName,expandedQuiltName", }, "context" : "", if (event.target.matches('.redirect')) { // Oops, not the right sequence, lets restart from the top. { "disableLabelLinks" : "false", "action" : "rerender" "action" : "rerender" { "event" : "deleteMessage", "context" : "", "eventActions" : [ }, ] "event" : "MessagesWidgetMessageEdit", { { } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", "actions" : [ watching = false; { "event" : "ProductMessageEdit", "context" : "envParam:quiltName", ] "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "action" : "rerender" { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "dialogContentCssClass" : "lia-panel-dialog-content", Betreff: EIN JAHR SPÄTER verbraucht die LTE-Einwah... Aktivierung GigaKombi Vorteil für CallYa mit Vodaf... Sim kann nicht aktiviert werden trotz Post Indent. We’ll be closed all day on December 25th and will have reduced hours of operation on December 24th. { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ } } "actions" : [ "action" : "rerender" ] LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044164}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044362}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044376}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044598}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492835}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506436}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506139}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504466}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506817}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506710}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506435}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505948}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505877}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505808}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505651}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505584}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505271}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505188}}]);

Ich Freue Mich Euch Kennenzulernen - Spanisch, Fahrschule Wels Preise, Hp Active Pen Laden, Körperverletzung Strafe Faustschlag, Gesundheitszentrum Wittenberge '' öffnungszeiten,